Volledig zicht
Gelijkwaardige producten
USB elektrische multifunctionele 5V laagspanningslichaamsverwarmingsdeken, Japanse en Koreaanse deken, verwarmingskussen voor de lunchpauze op kantoor
278 verkocht
€30,46€41,12
Kleur : lichtgrijs
Maat specificaties : 60x80cmH1
60x80cmH1
70x100cmH1
Hoeveelheid :
Rapport
Inclusief inbreuk op het auteursrechtGratis standaard verzending. Zie de details
Geschat tussen Mon, Oct 27 en Fri, Oct 31
U kunt het product binnen 30 dagen na ontvangst retourneren. Zie de details
Winkel met vertrouwen
Geld-terug-garantie
Ontvang het bestelde artikel of krijg uw geld terug. Meer informatie
Over dit item
De verkoper aanvaardt alle verantwoordelijkheid voor deze aanbieding.Item nummer: 31914327
Artikelspecificaties
Itembeschrijving van de verkoper
Warm reminder:
1. Size
The bedding is all hand-cut, so there will be a 3-5cm deviation, which is normal and not a quality issue.
2. Product
We can provide the size you need according to customer requirements, and we will give you a corresponding quote. We are direct suppliers, ensuring quality because of our professionalism
3. Fabric
The yarn fabric has small white spots printed on it, and there are some yarn knots in the fabric weave. These are normal phenomena in the craftsmanship process and cannot be avoided. They are not considered quality issues and will not be accepted as reasons for returns or exchanges.
4. Thread Ends
The bedding is all handmade products, and there may be some small loose threads, which are not considered quality issues.
5. Purpose
The bedding products in our store are all accessory bedding. For home buyers, please communicate with customer service carefully. Returns or exchanges due to reasons such as uncomfortable fabric or not soft enough will not be accepted
6. Color Difference
The products in our store are all taken from actual items. Due to fabric batches, monitors, and individual understanding of colors, there may be slight color differences, which is normal and not considered a reason for return or exchange
7. Shipping
Every day before 4 PM, same-day shipping is available.After customers place an order and make payment through Alipay, customer service staff will promptly hand over your order to the packing staff to arrange orders according to the payment time sequence.Large orders require production scheduling and take time. Please contact our customer service staff, and we will expedite production and shipping for you
8.
Due to the large size of the bedding, customers outside the province are generally shipped separately.Note: The shipping cost is borne by the buyer (if there is a designated shipping department or if door-to-door delivery is needed, please leave a message after purchasing the bedding). You can communicate with customer service for details
9. Bulk Products
Thank you for your support. Because we operate on low prices and high volume, we usually use freight services (mainly consignment). The quantity may vary widely, locations may be far or near, and costs may vary. Our company does not bear any shipping costs; we only handle the shipping and packaging of goods. After delivery, the shipping company will contact you to pick up the goods at the designated local shipping department. Generally, you will need to bring your ID card to pick up the goods yourself. If you need door-to-door delivery, you will need to discuss this with the shipping company as additional fees apply.We apologize for any inconvenience. Freight is calculated by package, and we will do our best to help you save on shipping costs.The shipping cost is based on the freight company's invoice.








Videos
Video's voor dit product